PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr034465.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 380aa    MW: 42350.7 Da    PI: 5.7636
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr034465.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.1e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ +++++G+g +W t ++++g++R++k+c++rw++yl
      Pbr034465.1 14 KGPWSPEEDATLKAYIEKHGTGgNWITLPQKIGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.92.1e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Pbr034465.1  69 GGFSEEEDNIICSLYMSIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.385966IPR017930Myb domain
SuperFamilySSF466893.72E-2711109IPR009057Homeodomain-like
SMARTSM007172.3E-121364IPR001005SANT/Myb domain
PfamPF002493.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-241569IPR009057Homeodomain-like
CDDcd001672.05E-91662No hitNo description
SMARTSM007171.9E-1167115IPR001005SANT/Myb domain
PROSITE profilePS5129415.76567117IPR017930Myb domain
PfamPF002492.3E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-2470117IPR009057Homeodomain-like
CDDcd001671.12E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDATLKAYIE KHGTGGNWIT LPQKIGLRRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYMSIGSRW SVIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
QRKQQEAQQS RRAAIFEQEM IKRSENNANF INISAGFFNQ NPCNWPELPV VPVANYQTHD  180
LQLMQDEASI KTMLINLGGR FSHDSDTSTT SFQYPLDISS TSSSDHQFYQ SSIDVLASTS  240
AANSNNYSQF PSTNFDASNG TGGSNSPTIF HGLDDQNNNL QADHLHQLTE LEVYDNSFAH  300
QHQQLGGFYY QASEETLNNG SSAGTSTASA ESEISWGDIN SLVYSTQMVA DYETCCQEAV  360
VVPQDQHSFF AEATYFGLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342199.10.0PREDICTED: transcription factor RAX3-like
TrEMBLM5WKM30.0M5WKM3_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s14630.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-75myb domain protein 84